VSI194 | |
Library | VS (Link to library) |
Clone ID | VSI194 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G21489 |
dictyBase ID | DDB0204674 |
Link to Contig | Contig-U06213-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI1-D/VSI194Q.Seq.d/ |
Representative seq. ID | VSI194P (Link to Original site) |
Representative DNA sequence | >VSI194 (VSI194Q) /CSM/VS/VSI1-D/VSI194Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | slsgmvrielphinvlskmdlieqngpldfnldfytdvldlkyldafldkdprlkkyskl |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1.10 |
Homology vs DNA |
|
dna update | 2009. 7. 5 |
Homology vs Protein |
|
protein update | 2009. 3.24 |
PSORT |
|
5' end seq. ID | VSI194F |
5' end seq. | >VSI194F.Seq |
Length of 5' end seq. | 526 |
3' end seq. ID | VSI194Z |
3' end seq. | >VSI194Z.Seq |
Length of 3' end seq. | 505 |
Connected seq. ID | VSI194P |
Connected seq. | >VSI194P.Seq |
Length of connected seq. | 1031 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |