VSI112 | |
Library | VS (Link to library) |
Clone ID | VSI112 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U14933-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI1-A/VSI112Q.Seq.d/ |
Representative seq. ID | VSI112E (Link to Original site) |
Representative DNA sequence | >VSI112 (VSI112Q) /CSM/VS/VSI1-A/VSI112Q.Seq.d/ |
sequence update | 2001. 3.23 |
Translated Amino Acid sequence | FPPCGELASPIMHFDNVTFSYSGKEADVLYRNLDLAIDLDSRIALVGPNGAGKSTLLKLM |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 7. 8 |
Homology vs DNA |
|
dna update | 2009. 7. 3 |
Homology vs Protein |
|
protein update | 2009. 3.24 |
PSORT |
|
5' end seq. ID | VSI112F |
5' end seq. | >VSI112F.Seq |
Length of 5' end seq. | 504 |
3' end seq. ID | VSI112Z |
3' end seq. | >VSI112Z.Seq |
Length of 3' end seq. | 275 |
Connected seq. ID | VSI112P |
Connected seq. | >VSI112P.Seq |
Length of connected seq. | 779 |
Full length Seq ID | VSI112E |
Full length Seq. | >VSI112E.Seq |
Length of full length seq. | 742 |