VSH826 | |
Library | VS (Link to library) |
Clone ID | VSH826 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U14496-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSH8-B/VSH826Q.Seq.d/ |
Representative seq. ID | VSH826E (Link to Original site) |
Representative DNA sequence | >VSH826 (VSH826Q) /CSM/VS/VSH8-B/VSH826Q.Seq.d/ |
sequence update | 2001. 3.25 |
Translated Amino Acid sequence | HIKMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLG |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.11.21 |
Homology vs DNA |
|
dna update | 2009. 6.30 |
Homology vs Protein |
|
protein update | 2009. 3.24 |
PSORT |
|
5' end seq. ID | VSH826F |
5' end seq. | >VSH826F.Seq |
Length of 5' end seq. | 471 |
3' end seq. ID | VSH826Z |
3' end seq. | >VSH826Z.Seq |
Length of 3' end seq. | 373 |
Connected seq. ID | VSH826P |
Connected seq. | >VSH826P.Seq |
Length of connected seq. | 844 |
Full length Seq ID | VSH826E |
Full length Seq. | >VSH826E.Seq |
Length of full length seq. | 524 |