VSH795 | |
Library | VS (Link to library) |
Clone ID | VSH795 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G02872 |
dictyBase ID | DDB0168344 |
Link to Contig | Contig-U12720-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSH7-D/VSH795Q.Seq.d/ |
Representative seq. ID | VSH795P (Link to Original site) |
Representative DNA sequence | >VSH795 (VSH795Q) /CSM/VS/VSH7-D/VSH795Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | mstrvqksailnenidkvwnvlrnfdfpskifpviessiiegdstpttvgairvlkwktg |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1.10 |
Homology vs DNA |
|
dna update | 2009. 6.30 |
Homology vs Protein |
|
protein update | 2009. 3.24 |
PSORT |
|
5' end seq. ID | VSH795F |
5' end seq. | >VSH795F.Seq |
Length of 5' end seq. | 476 |
3' end seq. ID | VSH795Z |
3' end seq. | >VSH795Z.Seq |
Length of 3' end seq. | 466 |
Connected seq. ID | VSH795P |
Connected seq. | >VSH795P.Seq |
Length of connected seq. | 942 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |