VSH329 | |
Library | VS (Link to library) |
Clone ID | VSH329 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U15105-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSH3-B/VSH329Q.Seq.d/ |
Representative seq. ID | VSH329E (Link to Original site) |
Representative DNA sequence | >VSH329 (VSH329Q) /CSM/VS/VSH3-B/VSH329Q.Seq.d/ |
sequence update | 2001. 3.25 |
Translated Amino Acid sequence | ASGLVKLHYLVNGHTLALLVQISPYKITSALKRMSSLHIQQVDTTKLDSERPNAQLLNVL |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.11.13 |
Homology vs DNA |
|
dna update | 2009. 6. 8 |
Homology vs Protein |
|
protein update | 2009. 3.23 |
PSORT |
|
5' end seq. ID | VSH329F |
5' end seq. | >VSH329F.Seq |
Length of 5' end seq. | 596 |
3' end seq. ID | VSH329Z |
3' end seq. | >VSH329Z.Seq |
Length of 3' end seq. | 674 |
Connected seq. ID | VSH329P |
Connected seq. | >VSH329P.Seq |
Length of connected seq. | 1270 |
Full length Seq ID | VSH329E |
Full length Seq. | >VSH329E.Seq |
Length of full length seq. | 686 |