VSG286 | |
Library | VS (Link to library) |
Clone ID | VSG286 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16209-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSG2-D/VSG286Q.Seq.d/ |
Representative seq. ID | VSG286E (Link to Original site) |
Representative DNA sequence | >VSG286 (VSG286Q) /CSM/VS/VSG2-D/VSG286Q.Seq.d/ |
sequence update | 2001. 3.25 |
Translated Amino Acid sequence | XKDNGHFIINLAKTWEKIQLAARVIVAIENPADISVISAKPLGQRAVLKFANFIGATAFS |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1. 9 |
Homology vs DNA |
|
dna update | 2004. 3.15 |
Homology vs Protein |
|
protein update | 2009. 3.23 |
PSORT |
|
5' end seq. ID | VSG286F |
5' end seq. | >VSG286F.Seq |
Length of 5' end seq. | 531 |
3' end seq. ID | VSG286Z |
3' end seq. | >VSG286Z.Seq |
Length of 3' end seq. | 607 |
Connected seq. ID | VSG286P |
Connected seq. | >VSG286P.Seq |
Length of connected seq. | 1138 |
Full length Seq ID | VSG286E |
Full length Seq. | >VSG286E.Seq |
Length of full length seq. | 624 |