VSG239 | |
Library | VS (Link to library) |
Clone ID | VSG239 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U15128-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSG2-B/VSG239Q.Seq.d/ |
Representative seq. ID | VSG239E (Link to Original site) |
Representative DNA sequence | >VSG239 (VSG239Q) /CSM/VS/VSG2-B/VSG239Q.Seq.d/ |
sequence update | 2001. 5.10 |
Translated Amino Acid sequence | rvrtktikrasklliekhyprltndfdtnkrtcdklakipskrlrnkiagfcthlmrria |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.11.13 |
Homology vs DNA |
|
dna update | 2003. 7.24 |
Homology vs Protein |
|
protein update | 2009. 4.30 |
PSORT |
|
5' end seq. ID | VSG239F |
5' end seq. | >VSG239F.Seq |
Length of 5' end seq. | 437 |
3' end seq. ID | VSG239Z |
3' end seq. | >VSG239Z.Seq |
Length of 3' end seq. | 458 |
Connected seq. ID | VSG239P |
Connected seq. | >VSG239P.Seq |
Length of connected seq. | 895 |
Full length Seq ID | VSG239E |
Full length Seq. | >VSG239E.Seq |
Length of full length seq. | 848 |