VSG224 | |
Library | VS (Link to library) |
Clone ID | VSG224 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | - |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSG2-A/VSG224Q.Seq.d/ |
Representative seq. ID | VSG224E (Link to Original site) |
Representative DNA sequence | >VSG224 (VSG224Q) /CSM/VS/VSG2-A/VSG224Q.Seq.d/ |
sequence update | 2001. 3.25 |
Translated Amino Acid sequence | xkfsrrrpsdsasnndekfplkknhatpnhnshnrnsfdaqadkiraailpeirkdskvd |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1. 9 |
Homology vs DNA |
|
dna update | 2004. 3.15 |
Homology vs Protein |
|
protein update | 2009. 3.22 |
PSORT |
|
5' end seq. ID | VSG224F |
5' end seq. | >VSG224F.Seq |
Length of 5' end seq. | 468 |
3' end seq. ID | VSG224Z |
3' end seq. | >VSG224Z.Seq |
Length of 3' end seq. | 585 |
Connected seq. ID | VSG224P |
Connected seq. | >VSG224P.Seq |
Length of connected seq. | 1053 |
Full length Seq ID | VSG224E |
Full length Seq. | >VSG224E.Seq |
Length of full length seq. | 745 |