VSG206 | |
Library | VS (Link to library) |
Clone ID | VSG206 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G23892 |
dictyBase ID | DDB0205292 |
Link to Contig | Contig-U01880-1|Contig-U02227-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSG2-A/VSG206Q.Seq.d/ |
Representative seq. ID | VSG206P (Link to Original site) |
Representative DNA sequence | >VSG206 (VSG206Q) /CSM/VS/VSG2-A/VSG206Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | QTILSDFFCHRISVLLLLLLLFFYWCSILVKIPDKEFFYIFLFFFLKXEILKKK--- |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 8.24 |
Homology vs Protein | |
protein update | 2009. 3.22 |
PSORT |
|
5' end seq. ID | VSG206F |
5' end seq. | >VSG206F.Seq |
Length of 5' end seq. | 165 |
3' end seq. ID | VSG206Z |
3' end seq. | >VSG206Z.Seq |
Length of 3' end seq. | 416 |
Connected seq. ID | VSG206P |
Connected seq. | >VSG206P.Seq |
Length of connected seq. | 581 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |