VSG174 | |
Library | VS (Link to library) |
Clone ID | VSG174 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U13926-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSG1-D/VSG174Q.Seq.d/ |
Representative seq. ID | VSG174P (Link to Original site) |
Representative DNA sequence | >VSG174 (VSG174Q) /CSM/VS/VSG1-D/VSG174Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | nkmrlllalffvlalvspsftqvwsncgtaadkfqitnvvldpptpvkgqditisasgil |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003.10.28 |
Homology vs DNA |
|
dna update | 2003. 8.24 |
Homology vs Protein |
|
protein update | 2009. 3.22 |
PSORT |
|
5' end seq. ID | VSG174F |
5' end seq. | >VSG174F.Seq |
Length of 5' end seq. | 503 |
3' end seq. ID | VSG174Z |
3' end seq. | >VSG174Z.Seq |
Length of 3' end seq. | 473 |
Connected seq. ID | VSG174P |
Connected seq. | >VSG174P.Seq |
Length of connected seq. | 976 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |