VSF229 | |
Library | VS (Link to library) |
Clone ID | VSF229 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U06686-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSF2-B/VSF229Q.Seq.d/ |
Representative seq. ID | VSF229P (Link to Original site) |
Representative DNA sequence | >VSF229 (VSF229Q) /CSM/VS/VSF2-B/VSF229Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | gsplelqnchpilcldlfehayvsdhgdknkyianfwscinwkfveakflnalvsdreyk |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1. 9 |
Homology vs DNA |
|
dna update | 2003. 8.23 |
Homology vs Protein |
|
protein update | 2009. 7.31 |
PSORT |
|
5' end seq. ID | VSF229F |
5' end seq. | >VSF229F.Seq |
Length of 5' end seq. | 283 |
3' end seq. ID | VSF229Z |
3' end seq. | >VSF229Z.Seq |
Length of 3' end seq. | 254 |
Connected seq. ID | VSF229P |
Connected seq. | >VSF229P.Seq |
Length of connected seq. | 537 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |