VSE581 | |
Library | VS (Link to library) |
Clone ID | VSE581 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U10011-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSE5-D/VSE581Q.Seq.d/ |
Representative seq. ID | VSE581E (Link to Original site) |
Representative DNA sequence | >VSE581 (VSE581Q) /CSM/VS/VSE5-D/VSE581Q.Seq.d/ |
sequence update | 2000. 8.25 |
Translated Amino Acid sequence | TALSILRYFISDLIQATYDECIDLFNKLPQRKIFEDKLFEEIQSIVLDQRKFDKLLEK*i |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004. 6. 2 |
Homology vs DNA |
|
dna update | 2003. 8.17 |
Homology vs Protein | |
protein update | 2009. 3.21 |
PSORT |
|
5' end seq. ID | - |
5' end seq. | - |
Length of 5' end seq. | - |
3' end seq. ID | - |
3' end seq. | - |
Length of 3' end seq. | - |
Connected seq. ID | - |
Connected seq. | - |
Length of connected seq. | - |
Full length Seq ID | VSE581E |
Full length Seq. | >VSE581E.Seq |
Length of full length seq. | 312 |