VSE427 | |
Library | VS (Link to library) |
Clone ID | VSE427 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G21352 |
dictyBase ID | DDB0217685 |
Link to Contig | Contig-U06638-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSE4-B/VSE427Q.Seq.d/ |
Representative seq. ID | VSE427Z (Link to Original site) |
Representative DNA sequence | >VSE427 (VSE427Q) /CSM/VS/VSE4-B/VSE427Q.Seq.d/ |
sequence update | 2000. 6.23 |
Translated Amino Acid sequence | ---IHETKYKCLQRYKLENVNFDENNLTEAVHSLAKLFNYDIKPTDVHYTALLSMIVRVA |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 8.22 |
Homology vs Protein |
|
protein update | 2009. 7.30 |
PSORT |
|
5' end seq. ID | - |
5' end seq. | - |
Length of 5' end seq. | - |
3' end seq. ID | VSE427Z |
3' end seq. | >VSE427Z.Seq |
Length of 3' end seq. | 564 |
Connected seq. ID | - |
Connected seq. | - |
Length of connected seq. | - |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |