VHQ355 | |
Library | VH (Link to library) |
Clone ID | VHQ355 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U11159-1|Contig-U12695-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHQ3-C/VHQ355Q.Seq.d/ |
Representative seq. ID | VHQ355P (Link to Original site) |
Representative DNA sequence | >VHQ355 (VHQ355Q) /CSM/VH/VHQ3-C/VHQ355Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | il*ALKKMREFLKDDYDVIVCGGGPVGLATAYRCAKAGKKVLCLEKSVFFNGGGSSGDVV |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2008.12.26 |
Homology vs Protein |
|
protein update | 2009. 7.22 |
PSORT |
|
5' end seq. ID | VHQ355F |
5' end seq. | >VHQ355F.Seq |
Length of 5' end seq. | 565 |
3' end seq. ID | VHQ355Z |
3' end seq. | >VHQ355Z.Seq |
Length of 3' end seq. | 322 |
Connected seq. ID | VHQ355P |
Connected seq. | >VHQ355P.Seq |
Length of connected seq. | 867 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |