VHP679 | |
Library | VH (Link to library) |
Clone ID | VHP679 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G23570 |
dictyBase ID | DDB0215379 |
Link to Contig | Contig-U11979-1|Contig-U13572-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP6-D/VHP679Q.Seq.d/ |
Representative seq. ID | VHP679P (Link to Original site) |
Representative DNA sequence | >VHP679 (VHP679Q) /CSM/VH/VHP6-D/VHP679Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | IPEYSELSSIEGLVEGATLEMVPVDYNERSAKLHVKRLRDIMNTGLTEFANMNNPSLFTS |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2008.12.21 |
Homology vs Protein |
|
protein update | 2009. 7.21 |
PSORT |
|
5' end seq. ID | VHP679F |
5' end seq. | >VHP679F.Seq |
Length of 5' end seq. | 581 |
3' end seq. ID | VHP679Z |
3' end seq. | >VHP679Z.Seq |
Length of 3' end seq. | 728 |
Connected seq. ID | VHP679P |
Connected seq. | >VHP679P.Seq |
Length of connected seq. | 1289 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |