VHL857 | |
Library | VH (Link to library) |
Clone ID | VHL857 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16182-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHL8-C/VHL857Q.Seq.d/ |
Representative seq. ID | VHL857E (Link to Original site) |
Representative DNA sequence | >VHL857 (VHL857Q) /CSM/VH/VHL8-C/VHL857Q.Seq.d/ |
sequence update | 2002.10.27 |
Translated Amino Acid sequence | tlikk*THVHIKIKIKEKKMKRTIIILLFVSLFVTFVLSQIPDNDPELCQQRIQREDCPQ |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1. 3 |
Homology vs DNA |
|
dna update | 2008.11.29 |
Homology vs Protein |
|
protein update | 2009. 3.15 |
PSORT |
|
5' end seq. ID | VHL857F |
5' end seq. | >VHL857F.Seq |
Length of 5' end seq. | 609 |
3' end seq. ID | VHL857Z |
3' end seq. | >VHL857Z.Seq |
Length of 3' end seq. | 449 |
Connected seq. ID | VHL857P |
Connected seq. | >VHL857P.Seq |
Length of connected seq. | 1038 |
Full length Seq ID | VHL857E |
Full length Seq. | >VHL857E.Seq |
Length of full length seq. | 940 |