VHG350 | |
Library | VH (Link to library) |
Clone ID | VHG350 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16508-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHG3-C/VHG350Q.Seq.d/ |
Representative seq. ID | VHG350P (Link to Original site) |
Representative DNA sequence | >VHG350 (VHG350Q) /CSM/VH/VHG3-C/VHG350Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | IGRMDYQDIEARLENKQMEFMWRSTQSTPENQVFTSVLRAMYCTPDGFNFEQGDDPIQDD |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.24 |
Homology vs DNA |
|
dna update | 2008.11. 2 |
Homology vs Protein |
|
protein update | 2009. 7.12 |
PSORT |
|
5' end seq. ID | VHG350F |
5' end seq. | >VHG350F.Seq |
Length of 5' end seq. | 595 |
3' end seq. ID | VHG350Z |
3' end seq. | >VHG350Z.Seq |
Length of 3' end seq. | 567 |
Connected seq. ID | VHG350P |
Connected seq. | >VHG350P.Seq |
Length of connected seq. | 1142 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |