VHE734 | |
Library | VH (Link to library) |
Clone ID | VHE734 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U14496-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHE7-B/VHE734Q.Seq.d/ |
Representative seq. ID | VHE734P (Link to Original site) |
Representative DNA sequence | >VHE734 (VHE734Q) /CSM/VH/VHE7-B/VHE734Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | vshikmptrfskhrksrgdvcagygrvgkhrkhpggrgnagglthhrinfdkyhpgyfgk |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2002.12.26 |
Homology vs DNA |
|
dna update | 2007. 9. 1 |
Homology vs Protein |
|
protein update | 2009. 7. 1 |
PSORT |
|
5' end seq. ID | VHE734F |
5' end seq. | >VHE734F.Seq |
Length of 5' end seq. | 541 |
3' end seq. ID | VHE734Z |
3' end seq. | >VHE734Z.Seq |
Length of 3' end seq. | 290 |
Connected seq. ID | VHE734P |
Connected seq. | >VHE734P.Seq |
Length of connected seq. | 811 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |