VHB796 | |
Library | VH (Link to library) |
Clone ID | VHB796 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16269-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-D/VHB796Q.Seq.d/ |
Representative seq. ID | VHB796E (Link to Original site) |
Representative DNA sequence | >VHB796 (VHB796Q) /CSM/VH/VHB7-D/VHB796Q.Seq.d/ |
sequence update | 2002.10.27 |
Translated Amino Acid sequence | ffrnhht*KMTTRPFVQVFDAQNKVVGKVKLPNVLTTPIRPDLVNFVHTNLNKNARQAYG |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2002.12.23 |
Homology vs DNA |
|
dna update | 2007. 4.16 |
Homology vs Protein |
|
protein update | 2009. 7.11 |
PSORT |
|
5' end seq. ID | VHB796F |
5' end seq. | >VHB796F.Seq |
Length of 5' end seq. | 628 |
3' end seq. ID | VHB796Z |
3' end seq. | >VHB796Z.Seq |
Length of 3' end seq. | 748 |
Connected seq. ID | VHB796P |
Connected seq. | >VHB796P.Seq |
Length of connected seq. | 1356 |
Full length Seq ID | VHB796E |
Full length Seq. | >VHB796E.Seq |
Length of full length seq. | 1153 |