VHB767 | |
Library | VH (Link to library) |
Clone ID | VHB767 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U11249-1|Contig-U12842-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-C/VHB767Q.Seq.d/ |
Representative seq. ID | VHB767P (Link to Original site) |
Representative DNA sequence | >VHB767 (VHB767Q) /CSM/VH/VHB7-C/VHB767Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | f*RDKMPQNKSQTIKLSHFLRDNLLNYPESKIFRELIQNAEDARADTVIIKVDEGSYPNN |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.24 |
Homology vs DNA |
|
dna update | 2007. 4.16 |
Homology vs Protein |
|
protein update | 2009. 6.27 |
PSORT |
|
5' end seq. ID | VHB767F |
5' end seq. | >VHB767F.Seq |
Length of 5' end seq. | 618 |
3' end seq. ID | VHB767Z |
3' end seq. | >VHB767Z.Seq |
Length of 3' end seq. | 781 |
Connected seq. ID | VHB767P |
Connected seq. | >VHB767P.Seq |
Length of connected seq. | 1379 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |