VHB594 | |
Library | VH (Link to library) |
Clone ID | VHB594 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16172-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-D/VHB594Q.Seq.d/ |
Representative seq. ID | VHB594E (Link to Original site) |
Representative DNA sequence | >VHB594 (VHB594Q) /CSM/VH/VHB5-D/VHB594Q.Seq.d/ |
sequence update | 2002.10.27 |
Translated Amino Acid sequence | klkn*NFIQIIFLNNKIYKMSTQGLVQLISNAQCHLRTSTNYNDVHTQFNAVLNYKNKGT |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1.12 |
Homology vs DNA |
|
dna update | 2007. 4. 5 |
Homology vs Protein |
|
protein update | 2009. 7.11 |
PSORT |
|
5' end seq. ID | VHB594F |
5' end seq. | >VHB594F.Seq |
Length of 5' end seq. | 589 |
3' end seq. ID | VHB594Z |
3' end seq. | >VHB594Z.Seq |
Length of 3' end seq. | 809 |
Connected seq. ID | VHB594P |
Connected seq. | >VHB594P.Seq |
Length of connected seq. | 1378 |
Full length Seq ID | VHB594E |
Full length Seq. | >VHB594E.Seq |
Length of full length seq. | 856 |