VHB529 | |
Library | VH (Link to library) |
Clone ID | VHB529 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U15722-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-B/VHB529Q.Seq.d/ |
Representative seq. ID | VHB529P (Link to Original site) |
Representative DNA sequence | >VHB529 (VHB529Q) /CSM/VH/VHB5-B/VHB529Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | i*kk*rkkhtkik*VRIKMKYLLVYLHILLFCLLKINSQKYCTYSGVGEDYNIKFDVLQT |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.24 |
Homology vs DNA |
|
dna update | 2007. 4. 4 |
Homology vs Protein |
|
protein update | 2009. 6.27 |
PSORT |
|
5' end seq. ID | VHB529F |
5' end seq. | >VHB529F.Seq |
Length of 5' end seq. | 630 |
3' end seq. ID | VHB529Z |
3' end seq. | >VHB529Z.Seq |
Length of 3' end seq. | 937 |
Connected seq. ID | VHB529P |
Connected seq. | >VHB529P.Seq |
Length of connected seq. | 1547 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |