VHB439 | |
Library | VH (Link to library) |
Clone ID | VHB439 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U12828-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB4-B/VHB439Q.Seq.d/ |
Representative seq. ID | (Link to Original site) |
Representative DNA sequence | >VHB439 (VHB439Q) /CSM/VH/VHB4-B/VHB439Q.Seq.d/ |
sequence update | 2002. 9.10 |
Translated Amino Acid sequence | ---mltxvvfql*CPINHYHYQSIVPIYIAGDSHCFSTAWTPLTIQGEQRLFHPXLVTGL |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1.11 |
Homology vs DNA |
|
dna update | 2007. 4. 4 |
Homology vs Protein | |
protein update | 2009. 2.23 |
PSORT |
|
5' end seq. ID | - |
5' end seq. | - |
Length of 5' end seq. | - |
3' end seq. ID | VHB439Z |
3' end seq. | >VHB439Z.Seq |
Length of 3' end seq. | 656 |
Connected seq. ID | - |
Connected seq. | - |
Length of connected seq. | - |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |