VFO694 | |
Library | VF (Link to library) |
Clone ID | VFO694 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16504-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFO6-D/VFO694Q.Seq.d/ |
Representative seq. ID | VFO694E (Link to Original site) |
Representative DNA sequence | >VFO694 (VFO694Q) /CSM/VF/VFO6-D/VFO694Q.Seq.d/ |
sequence update | 2001.11.24 |
Translated Amino Acid sequence | FYFILFLFFKEIIFYKKRMEEIKETVEKKNKEKKFLNDXKIISXGNNIKVXQKKDFXPKF |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2009. 6. 1 |
Homology vs Protein |
|
protein update | 2009. 7.11 |
PSORT |
|
5' end seq. ID | VFO694F |
5' end seq. | >VFO694F.Seq |
Length of 5' end seq. | 395 |
3' end seq. ID | VFO694Z |
3' end seq. | >VFO694Z.Seq |
Length of 3' end seq. | 616 |
Connected seq. ID | VFO694P |
Connected seq. | >VFO694P.Seq |
Length of connected seq. | 991 |
Full length Seq ID | VFO694E |
Full length Seq. | >VFO694E.Seq |
Length of full length seq. | 891 |