VFO164 | |
Library | VF (Link to library) |
Clone ID | VFO164 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U10135-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFO1-C/VFO164Q.Seq.d/ |
Representative seq. ID | VFO164E (Link to Original site) |
Representative DNA sequence | >VFO164 (VFO164Q) /CSM/VF/VFO1-C/VFO164Q.Seq.d/ |
sequence update | 2001.11.24 |
Translated Amino Acid sequence | kgllkqlssyvgkditslislpvwifepvsflqvmseplq*NALLSKASKQDSEFLCLAY |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2002.12.19 |
Homology vs DNA |
|
dna update | 2009. 5.15 |
Homology vs Protein |
|
protein update | 2009. 7.11 |
PSORT |
|
5' end seq. ID | VFO164F |
5' end seq. | >VFO164F.Seq |
Length of 5' end seq. | 583 |
3' end seq. ID | VFO164Z |
3' end seq. | >VFO164Z.Seq |
Length of 3' end seq. | 741 |
Connected seq. ID | VFO164P |
Connected seq. | >VFO164P.Seq |
Length of connected seq. | 1304 |
Full length Seq ID | VFO164E |
Full length Seq. | >VFO164E.Seq |
Length of full length seq. | 1155 |