VFM206 | |
Library | VF (Link to library) |
Clone ID | VFM206 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U15252-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFM2-A/VFM206Q.Seq.d/ |
Representative seq. ID | VFM206E (Link to Original site) |
Representative DNA sequence | >VFM206 (VFM206Q) /CSM/VF/VFM2-A/VFM206Q.Seq.d/ |
sequence update | 2001.11.24 |
Translated Amino Acid sequence | f*ycs*NKMNKLISLLLVCLVAIALVNADCAIDFDSDTVNSVTSSDWSCLAASNDRVIMQ |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2002.12.19 |
Homology vs DNA |
|
dna update | 2009. 3.27 |
Homology vs Protein |
|
protein update | 2009. 7.11 |
PSORT |
|
5' end seq. ID | VFM206F |
5' end seq. | >VFM206F.Seq |
Length of 5' end seq. | 627 |
3' end seq. ID | VFM206Z |
3' end seq. | >VFM206Z.Seq |
Length of 3' end seq. | 629 |
Connected seq. ID | VFM206P |
Connected seq. | >VFM206P.Seq |
Length of connected seq. | 1236 |
Full length Seq ID | VFM206E |
Full length Seq. | >VFM206E.Seq |
Length of full length seq. | 855 |