VFL371 | |
Library | VF (Link to library) |
Clone ID | VFL371 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16382-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFL3-C/VFL371Q.Seq.d/ |
Representative seq. ID | VFL371E (Link to Original site) |
Representative DNA sequence | >VFL371 (VFL371Q) /CSM/VF/VFL3-C/VFL371Q.Seq.d/ |
sequence update | 2001.11.24 |
Translated Amino Acid sequence | ilnsniyi*ii*kwtvkmfkl*lsitvlvcvkpvllvmmphvlfshqllvvqdtlvlwsv |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.12. 4 |
Homology vs DNA |
|
dna update | 2009. 3.10 |
Homology vs Protein |
|
protein update | 2009. 7.11 |
PSORT |
|
5' end seq. ID | VFL371F |
5' end seq. | >VFL371F.Seq |
Length of 5' end seq. | 642 |
3' end seq. ID | VFL371Z |
3' end seq. | >VFL371Z.Seq |
Length of 3' end seq. | 636 |
Connected seq. ID | VFL371P |
Connected seq. | >VFL371P.Seq |
Length of connected seq. | 1258 |
Full length Seq ID | VFL371E |
Full length Seq. | >VFL371E.Seq |
Length of full length seq. | 1168 |