VFL167 | |
Library | VF (Link to library) |
Clone ID | VFL167 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U12091-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFL1-C/VFL167Q.Seq.d/ |
Representative seq. ID | VFL167E (Link to Original site) |
Representative DNA sequence | >VFL167 (VFL167Q) /CSM/VF/VFL1-C/VFL167Q.Seq.d/ |
sequence update | 2001.11.24 |
Translated Amino Acid sequence | TIIKTTNTKMIKNRKLDITSTNVAGIGTDLDKKCRLDAASTEAQWKGVGQAPGLKIWRIE |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2009. 3. 5 |
Homology vs Protein |
|
protein update | 2009. 7.11 |
PSORT |
|
5' end seq. ID | VFL167F |
5' end seq. | >VFL167F.Seq |
Length of 5' end seq. | 627 |
3' end seq. ID | VFL167Z |
3' end seq. | >VFL167Z.Seq |
Length of 3' end seq. | 727 |
Connected seq. ID | VFL167P |
Connected seq. | >VFL167P.Seq |
Length of connected seq. | 1334 |
Full length Seq ID | VFL167E |
Full length Seq. | >VFL167E.Seq |
Length of full length seq. | 1186 |