VFK428 | |
Library | VF (Link to library) |
Clone ID | VFK428 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U13202-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK4-B/VFK428Q.Seq.d/ |
Representative seq. ID | VFK428E (Link to Original site) |
Representative DNA sequence | >VFK428 (VFK428Q) /CSM/VF/VFK4-B/VFK428Q.Seq.d/ |
sequence update | 2001.11.24 |
Translated Amino Acid sequence | VIIKSNKKKYKMRVLLSLVVILFIINSAFAVKINIGRPTKSHKTIHHETWVEEQTDQFDN |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.12. 4 |
Homology vs DNA |
|
dna update | 2003.10.29 |
Homology vs Protein |
|
protein update | 2009. 7.11 |
PSORT |
|
5' end seq. ID | VFK428F |
5' end seq. | >VFK428F.Seq |
Length of 5' end seq. | 647 |
3' end seq. ID | VFK428Z |
3' end seq. | >VFK428Z.Seq |
Length of 3' end seq. | 710 |
Connected seq. ID | VFK428P |
Connected seq. | >VFK428P.Seq |
Length of connected seq. | 1337 |
Full length Seq ID | VFK428E |
Full length Seq. | >VFK428E.Seq |
Length of full length seq. | 952 |