VFK216 | |
Library | VF (Link to library) |
Clone ID | VFK216 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U10386-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-A/VFK216Q.Seq.d/ |
Representative seq. ID | VFK216E (Link to Original site) |
Representative DNA sequence | >VFK216 (VFK216Q) /CSM/VF/VFK2-A/VFK216Q.Seq.d/ |
sequence update | 2001.11.24 |
Translated Amino Acid sequence | EMKEKTMDDDDIKIKFVNIKSENVFLIETYFKGFEKLPRRDWERGLEYIVGQMENDHVVT |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2002.12.18 |
Homology vs DNA |
|
dna update | 2009. 2. 4 |
Homology vs Protein |
|
protein update | 2009. 7.11 |
PSORT |
|
5' end seq. ID | VFK216F |
5' end seq. | >VFK216F.Seq |
Length of 5' end seq. | 628 |
3' end seq. ID | VFK216Z |
3' end seq. | >VFK216Z.Seq |
Length of 3' end seq. | 699 |
Connected seq. ID | VFK216P |
Connected seq. | >VFK216P.Seq |
Length of connected seq. | 1307 |
Full length Seq ID | VFK216E |
Full length Seq. | >VFK216E.Seq |
Length of full length seq. | 1236 |