VFJ167 | |
Library | VF (Link to library) |
Clone ID | VFJ167 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16529-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFJ1-C/VFJ167Q.Seq.d/ |
Representative seq. ID | VFJ167P (Link to Original site) |
Representative DNA sequence | >VFJ167 (VFJ167Q) /CSM/VF/VFJ1-C/VFJ167Q.Seq.d/ |
sequence update | 2001.11.22 |
Translated Amino Acid sequence | krysikn*KMSVDANKVKFFFGKNCTGESFEYNKGETVRFNNGDKWNDKFMSCLVGSNVR |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2009. 1.13 |
Homology vs Protein |
|
protein update | 2009. 2.15 |
PSORT |
|
5' end seq. ID | VFJ167F |
5' end seq. | >VFJ167F.Seq |
Length of 5' end seq. | 578 |
3' end seq. ID | VFJ167Z |
3' end seq. | >VFJ167Z.Seq |
Length of 3' end seq. | 741 |
Connected seq. ID | VFJ167P |
Connected seq. | >VFJ167P.Seq |
Length of connected seq. | 1299 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |