VFI734 | |
Library | VF (Link to library) |
Clone ID | VFI734 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U11967-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFI7-B/VFI734Q.Seq.d/ |
Representative seq. ID | VFI734P (Link to Original site) |
Representative DNA sequence | >VFI734 (VFI734Q) /CSM/VF/VFI7-B/VFI734Q.Seq.d/ |
sequence update | 2001.11.22 |
Translated Amino Acid sequence | kkk*KMTKVETLEFPRRKKESNENSTLSQPDAAAELNKDDKETDPSTLSKEECIKKSDEY |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2009. 4. 4 |
Homology vs DNA |
|
dna update | 2009. 1. 8 |
Homology vs Protein |
|
protein update | 2009. 6.21 |
PSORT |
|
5' end seq. ID | VFI734F |
5' end seq. | >VFI734F.Seq |
Length of 5' end seq. | 615 |
3' end seq. ID | VFI734Z |
3' end seq. | >VFI734Z.Seq |
Length of 3' end seq. | 757 |
Connected seq. ID | VFI734P |
Connected seq. | >VFI734P.Seq |
Length of connected seq. | 1352 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |