VFI285 | |
Library | VF (Link to library) |
Clone ID | VFI285 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16276-1|Contig-U16494-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFI2-D/VFI285Q.Seq.d/ |
Representative seq. ID | VFI285P (Link to Original site) |
Representative DNA sequence | >VFI285 (VFI285Q) /CSM/VF/VFI2-D/VFI285Q.Seq.d/ |
sequence update | 2001.11.22 |
Translated Amino Acid sequence | vhpiskmpsnktlkikkilgkkqkqnrpvphwirlrtdntirynnkrrhwrrtklgi*TP |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2004. 3.11 |
Homology vs Protein |
|
protein update | 2009. 6.21 |
PSORT |
|
5' end seq. ID | VFI285F |
5' end seq. | >VFI285F.Seq |
Length of 5' end seq. | 274 |
3' end seq. ID | VFI285Z |
3' end seq. | >VFI285Z.Seq |
Length of 3' end seq. | 400 |
Connected seq. ID | VFI285P |
Connected seq. | >VFI285P.Seq |
Length of connected seq. | 654 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |