VFF572 | |
Library | VF (Link to library) |
Clone ID | VFF572 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16513-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFF5-C/VFF572Q.Seq.d/ |
Representative seq. ID | VFF572E (Link to Original site) |
Representative DNA sequence | >VFF572 (VFF572Q) /CSM/VF/VFF5-C/VFF572Q.Seq.d/ |
sequence update | 2001. 6. 9 |
Translated Amino Acid sequence | LLIIHPQRMKILLFVTLIALAFVALCSAEGNVVVLSPDNFDTVVDGSKTVFVKFYAPWCG |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.12. 4 |
Homology vs DNA |
|
dna update | 2003. 9.21 |
Homology vs Protein |
|
protein update | 2009. 7.10 |
PSORT |
|
5' end seq. ID | VFF572F |
5' end seq. | >VFF572F.Seq |
Length of 5' end seq. | 695 |
3' end seq. ID | VFF572Z |
3' end seq. | >VFF572Z.Seq |
Length of 3' end seq. | 764 |
Connected seq. ID | VFF572P |
Connected seq. | >VFF572P.Seq |
Length of connected seq. | 1459 |
Full length Seq ID | VFF572E |
Full length Seq. | >VFF572E.Seq |
Length of full length seq. | 1117 |