VFE845 | |
Library | VF (Link to library) |
Clone ID | VFE845 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U14349-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFE8-B/VFE845Q.Seq.d/ |
Representative seq. ID | VFE845P (Link to Original site) |
Representative DNA sequence | >VFE845 (VFE845Q) /CSM/VF/VFE8-B/VFE845Q.Seq.d/ |
sequence update | 2001. 6. 1 |
Translated Amino Acid sequence | ltqlnkklyiknvfrycfssklrfnlqrfkvrs*iwwyhlqnl*rfkrnhc*lhltswlf |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.10.16 |
Homology vs DNA |
|
dna update | 2003. 9.20 |
Homology vs Protein |
|
protein update | 2009. 6.19 |
PSORT |
|
5' end seq. ID | VFE845F |
5' end seq. | >VFE845F.Seq |
Length of 5' end seq. | 477 |
3' end seq. ID | VFE845Z |
3' end seq. | >VFE845Z.Seq |
Length of 3' end seq. | 453 |
Connected seq. ID | VFE845P |
Connected seq. | >VFE845P.Seq |
Length of connected seq. | 930 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |