VFE256 | |
Library | VF (Link to library) |
Clone ID | VFE256 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16239-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFE2-C/VFE256Q.Seq.d/ |
Representative seq. ID | VFE256P (Link to Original site) |
Representative DNA sequence | >VFE256 (VFE256Q) /CSM/VF/VFE2-C/VFE256Q.Seq.d/ |
sequence update | 2001. 6. 1 |
Translated Amino Acid sequence | sniiiikdw*KTMSKLLILLLLSLVASIFSTPLDDYVNAPDDTYKWTLNNTIEYETFTGY |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 9.18 |
Homology vs Protein |
|
protein update | 2009. 6.18 |
PSORT |
|
5' end seq. ID | VFE256F |
5' end seq. | >VFE256F.Seq |
Length of 5' end seq. | 507 |
3' end seq. ID | VFE256Z |
3' end seq. | >VFE256Z.Seq |
Length of 3' end seq. | 323 |
Connected seq. ID | VFE256P |
Connected seq. | >VFE256P.Seq |
Length of connected seq. | 830 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |