VFE106 | |
Library | VF (Link to library) |
Clone ID | VFE106 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G00425 |
dictyBase ID | DDB0185421 |
Link to Contig | Contig-U16165-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFE1-A/VFE106Q.Seq.d/ |
Representative seq. ID | VFE106P (Link to Original site) |
Representative DNA sequence | >VFE106 (VFE106Q) /CSM/VF/VFE1-A/VFE106Q.Seq.d/ |
sequence update | 2001. 6. 1 |
Translated Amino Acid sequence | sqkk*KMKLLILIISLLISLSSCHIKQIILDEDTNFVVSWDYSNSNITFELEGDFKGWFA |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 9.16 |
Homology vs Protein |
|
protein update | 2009. 2.10 |
PSORT |
|
5' end seq. ID | VFE106F |
5' end seq. | >VFE106F.Seq |
Length of 5' end seq. | 514 |
3' end seq. ID | VFE106Z |
3' end seq. | >VFE106Z.Seq |
Length of 3' end seq. | 210 |
Connected seq. ID | VFE106P |
Connected seq. | >VFE106P.Seq |
Length of connected seq. | 724 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |