VFD691 | |
Library | VF (Link to library) |
Clone ID | VFD691 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G23253 |
dictyBase ID | DDB0203342 |
Link to Contig | Contig-U06086-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFD6-D/VFD691Q.Seq.d/ |
Representative seq. ID | VFD691E (Link to Original site) |
Representative DNA sequence | >VFD691 (VFD691Q) /CSM/VF/VFD6-D/VFD691Q.Seq.d/ |
sequence update | 2001. 6. 9 |
Translated Amino Acid sequence | *XDFIQLAQLFFREQNVDPPASLYTIDNTIANIKSSLAEVIKPNQDPSSLTFRYMMIVDP |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 9.15 |
Homology vs Protein |
|
protein update | 2009. 7.10 |
PSORT |
|
5' end seq. ID | VFD691F |
5' end seq. | >VFD691F.Seq |
Length of 5' end seq. | 636 |
3' end seq. ID | VFD691Z |
3' end seq. | >VFD691Z.Seq |
Length of 3' end seq. | 690 |
Connected seq. ID | VFD691P |
Connected seq. | >VFD691P.Seq |
Length of connected seq. | 1326 |
Full length Seq ID | VFD691E |
Full length Seq. | >VFD691E.Seq |
Length of full length seq. | 1250 |