VFC716 | |
Library | VF (Link to library) |
Clone ID | VFC716 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16504-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFC7-A/VFC716Q.Seq.d/ |
Representative seq. ID | VFC716E (Link to Original site) |
Representative DNA sequence | >VFC716 (VFC716Q) /CSM/VF/VFC7-A/VFC716Q.Seq.d/ |
sequence update | 2001. 6. 9 |
Translated Amino Acid sequence | ilfyfifif*rnnfl*kkngrnkrnc*KKNKEKKYLNDYKIISEGNNIKVLQKKDFKPKF |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 9.13 |
Homology vs Protein |
|
protein update | 2009. 7.10 |
PSORT |
|
5' end seq. ID | VFC716F |
5' end seq. | >VFC716F.Seq |
Length of 5' end seq. | 568 |
3' end seq. ID | VFC716Z |
3' end seq. | >VFC716Z.Seq |
Length of 3' end seq. | 711 |
Connected seq. ID | VFC716P |
Connected seq. | >VFC716P.Seq |
Length of connected seq. | 1279 |
Full length Seq ID | VFC716E |
Full length Seq. | >VFC716E.Seq |
Length of full length seq. | 1023 |