VFB882 | |
Library | VF (Link to library) |
Clone ID | VFB882 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U13884-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB8-D/VFB882Q.Seq.d/ |
Representative seq. ID | VFB882E (Link to Original site) |
Representative DNA sequence | >VFB882 (VFB882Q) /CSM/VF/VFB8-D/VFB882Q.Seq.d/ |
sequence update | 2001. 6. 9 |
Translated Amino Acid sequence | GELLREGERLVQQKVHPQTIISGWRLALETARAALQSSTQDHSSDKVKFREDLLNIARTT |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.11.27 |
Homology vs DNA |
|
dna update | 2003. 9.10 |
Homology vs Protein |
|
protein update | 2009. 7.10 |
PSORT |
|
5' end seq. ID | VFB882F |
5' end seq. | >VFB882F.Seq |
Length of 5' end seq. | 586 |
3' end seq. ID | VFB882Z |
3' end seq. | >VFB882Z.Seq |
Length of 3' end seq. | 744 |
Connected seq. ID | VFB882P |
Connected seq. | >VFB882P.Seq |
Length of connected seq. | 1330 |
Full length Seq ID | VFB882E |
Full length Seq. | >VFB882E.Seq |
Length of full length seq. | 1263 |