VFB676 | |
Library | VF (Link to library) |
Clone ID | VFB676 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U12091-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-D/VFB676Q.Seq.d/ |
Representative seq. ID | VFB676E (Link to Original site) |
Representative DNA sequence | >VFB676 (VFB676Q) /CSM/VF/VFB6-D/VFB676Q.Seq.d/ |
sequence update | 2001. 6. 9 |
Translated Amino Acid sequence | i*KTIIKTTNTKMIKNRKLDITSTNVAGIGTDLDKKCRLDAASTEAQWKGVGQAPGLKIW |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004. 8. 9 |
Homology vs DNA |
|
dna update | 2003. 9. 5 |
Homology vs Protein |
|
protein update | 2009. 7.10 |
PSORT |
|
5' end seq. ID | VFB676F |
5' end seq. | >VFB676F.Seq |
Length of 5' end seq. | 574 |
3' end seq. ID | VFB676Z |
3' end seq. | >VFB676Z.Seq |
Length of 3' end seq. | 719 |
Connected seq. ID | VFB676P |
Connected seq. | >VFB676P.Seq |
Length of connected seq. | 1293 |
Full length Seq ID | VFB676E |
Full length Seq. | >VFB676E.Seq |
Length of full length seq. | 1203 |