VFB457 | |
Library | VF (Link to library) |
Clone ID | VFB457 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G02514 |
dictyBase ID | DDB0186012 |
Link to Contig | Contig-U03440-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB4-C/VFB457Q.Seq.d/ |
Representative seq. ID | VFB457E (Link to Original site) |
Representative DNA sequence | >VFB457 (VFB457Q) /CSM/VF/VFB4-C/VFB457Q.Seq.d/ |
sequence update | 2001. 6. 9 |
Translated Amino Acid sequence | f*ikfkfltigkahththtyi*RVTMSKEIFIGIDGGGTKTSTVAVDSNGQELARHTSPC |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004. 6. 1 |
Homology vs DNA |
|
dna update | 2003. 8.30 |
Homology vs Protein |
|
protein update | 2009. 7.10 |
PSORT |
|
5' end seq. ID | VFB457F |
5' end seq. | >VFB457F.Seq |
Length of 5' end seq. | 543 |
3' end seq. ID | VFB457Z |
3' end seq. | >VFB457Z.Seq |
Length of 3' end seq. | 700 |
Connected seq. ID | VFB457P |
Connected seq. | >VFB457P.Seq |
Length of connected seq. | 1243 |
Full length Seq ID | VFB457E |
Full length Seq. | >VFB457E.Seq |
Length of full length seq. | 1056 |