VFB422 | |
Library | VF (Link to library) |
Clone ID | VFB422 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16320-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB4-A/VFB422Q.Seq.d/ |
Representative seq. ID | VFB422E (Link to Original site) |
Representative DNA sequence | >VFB422 (VFB422Q) /CSM/VF/VFB4-A/VFB422Q.Seq.d/ |
sequence update | 2001. 6. 9 |
Translated Amino Acid sequence | ilycsfiffx*YIYNXKMARRYDQRTTIFSPEGRVYQVEYAMTAIRHAGATVGILAKDGI |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2002.12.15 |
Homology vs DNA |
|
dna update | 2003. 8.30 |
Homology vs Protein |
|
protein update | 2009. 7.10 |
PSORT |
|
5' end seq. ID | VFB422F |
5' end seq. | >VFB422F.Seq |
Length of 5' end seq. | 594 |
3' end seq. ID | VFB422Z |
3' end seq. | >VFB422Z.Seq |
Length of 3' end seq. | 654 |
Connected seq. ID | VFB422P |
Connected seq. | >VFB422P.Seq |
Length of connected seq. | 1248 |
Full length Seq ID | VFB422E |
Full length Seq. | >VFB422E.Seq |
Length of full length seq. | 773 |