VFB178 | |
Library | VF (Link to library) |
Clone ID | VFB178 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16382-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB1-D/VFB178Q.Seq.d/ |
Representative seq. ID | VFB178P (Link to Original site) |
Representative DNA sequence | >VFB178 (VFB178Q) /CSM/VF/VFB1-D/VFB178Q.Seq.d/ |
sequence update | 2001. 6. 1 |
Translated Amino Acid sequence | YINHLKMDGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSY |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 8.27 |
Homology vs Protein |
|
protein update | 2009. 6.17 |
PSORT |
|
5' end seq. ID | VFB178F |
5' end seq. | >VFB178F.Seq |
Length of 5' end seq. | 361 |
3' end seq. ID | VFB178Z |
3' end seq. | >VFB178Z.Seq |
Length of 3' end seq. | 548 |
Connected seq. ID | VFB178P |
Connected seq. | >VFB178P.Seq |
Length of connected seq. | 909 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |