VFA444 | |
Library | VF (Link to library) |
Clone ID | VFA444 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U15823-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFA4-B/VFA444Q.Seq.d/ |
Representative seq. ID | VFA444E (Link to Original site) |
Representative DNA sequence | >VFA444 (VFA444Q) /CSM/VF/VFA4-B/VFA444Q.Seq.d/ |
sequence update | 2001. 6. 9 |
Translated Amino Acid sequence | *MEADPSLVSYAGQHGEWETREISIFGVVKSFISQLSIGQELTKVSMPSIFLMPYSILEL |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 8.16 |
Homology vs Protein |
|
protein update | 2009. 7. 9 |
PSORT |
|
5' end seq. ID | VFA444F |
5' end seq. | >VFA444F.Seq |
Length of 5' end seq. | 579 |
3' end seq. ID | VFA444Z |
3' end seq. | >VFA444Z.Seq |
Length of 3' end seq. | 737 |
Connected seq. ID | VFA444P |
Connected seq. | >VFA444P.Seq |
Length of connected seq. | 1316 |
Full length Seq ID | VFA444E |
Full length Seq. | >VFA444E.Seq |
Length of full length seq. | 1046 |