VFA214 | |
Library | VF (Link to library) |
Clone ID | VFA214 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U14969-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFA2-A/VFA214Q.Seq.d/ |
Representative seq. ID | VFA214E (Link to Original site) |
Representative DNA sequence | >VFA214 (VFA214Q) /CSM/VF/VFA2-A/VFA214Q.Seq.d/ |
sequence update | 2001. 6. 9 |
Translated Amino Acid sequence | spf*ngyqffqannltfnfficli*ISSSNIPTLITQYNRMFSSANNNNSLSNNKPPSVV |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2002.12.15 |
Homology vs DNA |
|
dna update | 2003. 8.15 |
Homology vs Protein |
|
protein update | 2009. 7. 9 |
PSORT |
|
5' end seq. ID | VFA214F |
5' end seq. | >VFA214F.Seq |
Length of 5' end seq. | 476 |
3' end seq. ID | VFA214Z |
3' end seq. | >VFA214Z.Seq |
Length of 3' end seq. | 683 |
Connected seq. ID | VFA214P |
Connected seq. | >VFA214P.Seq |
Length of connected seq. | 1159 |
Full length Seq ID | VFA214E |
Full length Seq. | >VFA214E.Seq |
Length of full length seq. | 1102 |