SLK832 | |
Library | SL (Link to library) |
Clone ID | SLK832 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U11519-1|Contig-U15821-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLK8-B/SLK832Q.Seq.d/ |
Representative seq. ID | SLK832P (Link to Original site) |
Representative DNA sequence | >SLK832 (SLK832Q) /CSM/SL/SLK8-B/SLK832Q.Seq.d/ |
sequence update | 1999. 3. 8 |
Translated Amino Acid sequence | sffsk*ilfekr*iskkv*KLPSGDISKSNDSPIELWDNLMNGFDGIIESRERWSDNFNE |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 7.16 |
Homology vs Protein |
|
protein update | 2009. 1.26 |
PSORT |
|
5' end seq. ID | SLK832F |
5' end seq. | >SLK832F.Seq |
Length of 5' end seq. | 192 |
3' end seq. ID | SLK832Z |
3' end seq. | >SLK832Z.Seq |
Length of 3' end seq. | 247 |
Connected seq. ID | SLK832P |
Connected seq. | >SLK832P.Seq |
Length of connected seq. | 439 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |