SLK302 | |
Library | SL (Link to library) |
Clone ID | SLK302 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16510-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLK3-A/SLK302Q.Seq.d/ |
Representative seq. ID | SLK302P (Link to Original site) |
Representative DNA sequence | >SLK302 (SLK302Q) /CSM/SL/SLK3-A/SLK302Q.Seq.d/ |
sequence update | 1999. 3. 8 |
Translated Amino Acid sequence | hlhhlhlhhlqqlqlqlqlqlqlqlqlqlqpqpqlqpqlqpqlplkfnqktffikyhynn |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 6.12 |
Homology vs DNA |
|
dna update | 2003. 7.16 |
Homology vs Protein |
|
protein update | 2009. 6. 7 |
PSORT |
|
5' end seq. ID | SLK302F |
5' end seq. | >SLK302F.Seq |
Length of 5' end seq. | 309 |
3' end seq. ID | SLK302Z |
3' end seq. | >SLK302Z.Seq |
Length of 3' end seq. | 161 |
Connected seq. ID | SLK302P |
Connected seq. | >SLK302P.Seq |
Length of connected seq. | 470 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |