AFK463 | |
Library | AF (Link to library) |
Clone ID | AFK463 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16377-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFK4-C/AFK463Q.Seq.d/ |
Representative seq. ID | AFK463P (Link to Original site) |
Representative DNA sequence | >AFK463 (AFK463Q) /CSM/AF/AFK4-C/AFK463Q.Seq.d/ |
sequence update | 2001. 6. 1 |
Translated Amino Acid sequence | tvgllvfitlqfnyihiyi*TIIKMGFRFLDIVKPFTSLVPEVGQPDRKIPFREKVLWTA |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2009. 4. 4 |
Homology vs DNA |
|
dna update | 2004. 7.31 |
Homology vs Protein |
|
protein update | 2009. 4.24 |
PSORT |
|
5' end seq. ID | AFK463F |
5' end seq. | >AFK463F.Seq |
Length of 5' end seq. | 604 |
3' end seq. ID | AFK463Z |
3' end seq. | >AFK463Z.Seq |
Length of 3' end seq. | 486 |
Connected seq. ID | AFK463P |
Connected seq. | >AFK463P.Seq |
Length of connected seq. | 1090 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |