SLC601 | |
Library | SL (Link to library) |
Clone ID | SLC601 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G01088 |
dictyBase ID | DDB0186974 |
Link to Contig | Contig-U14173-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-A/SLC601Q.Seq.d/ |
Representative seq. ID | SLC601E (Link to Original site) |
Representative DNA sequence | >SLC601 (SLC601Q) /CSM/SL/SLC6-A/SLC601Q.Seq.d/ |
sequence update | 2002. 8. 2 |
Translated Amino Acid sequence | lvklfsivlsvllffigdvfslssseyqctfnffnkisnvnqefyynsntllydfcnspl |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003.11.18 |
Homology vs Protein |
|
protein update | 2009. 7. 4 |
PSORT |
|
5' end seq. ID | SLC601F |
5' end seq. | >SLC601F.Seq |
Length of 5' end seq. | 1278 |
3' end seq. ID | SLC601Z |
3' end seq. | >SLC601Z.Seq |
Length of 3' end seq. | 524 |
Connected seq. ID | SLC601P |
Connected seq. | >SLC601P.Seq |
Length of connected seq. | 1792 |
Full length Seq ID | SLC601E |
Full length Seq. | >SLC601E.Seq |
Length of full length seq. | 1630 |